PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000463846
Common NameMYB5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 320aa    MW: 34631.1 Da    PI: 8.6448
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000463846genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.8e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++vk +G+++W++I++ ++ gR++k+c++rw + 
    MDP0000463846 12 KGPWSPEEDEALQNLVKNYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding54.62.5e-1766108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEd+ +++a++++G++ W+tIar ++ gRt++ +k++w++ 
    MDP0000463846  66 PFSPEEDDTIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 108
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.855762IPR017930Myb domain
SuperFamilySSF466894.49E-329105IPR009057Homeodomain-like
SMARTSM007171.1E-161160IPR001005SANT/Myb domain
PfamPF002492.7E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-261365IPR009057Homeodomain-like
CDDcd001674.55E-161456No hitNo description
SMARTSM007177.7E-1563111IPR001005SANT/Myb domain
PROSITE profilePS5129420.82864113IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2366112IPR009057Homeodomain-like
CDDcd001675.19E-1266109No hitNo description
PfamPF002493.9E-1566108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MASTKKVVDR IKGPWSPEED EALQNLVKNY GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
EVEHRPFSPE EDDTIIRAHA RFGNKWATIA RLLNGRTDNA IKNHWNSTLK RKSSSMSEDL  120
SSDVQAHPPH KRSASVGAVP VTGLYFNPGS PSGSDLSDSS LPGGVSPSSQ VFTPFARPLP  180
PPIALPPMEA VTSAMAVDPP TSLSLSLPGS ESCDGSSHMA SGFGTNSIVG PAQIVQQAPE  240
VTAPPRAVGL PPAPRQSNQN SETGHDQQFF SSEFLDMMQE MIRKEVRNYM TGIEQKGLCM  300
HTEAIRNAVV KRIGISRIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-40111123104C-Myb DNA-Binding Domain
1msf_C2e-40111123104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.126450.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6273120.0AB627312.1 Malus x domestica mRNA, microsatellite: MEST188, clone: SAM01_20_H07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001287808.10.0transcription factor MYB44-like
SwissprotQ9FDW14e-90MYB44_ARATH; Transcription factor MYB44
TrEMBLD9ZJ660.0D9ZJ66_MALDO; MYB domain class transcription factor
STRINGPOPTR_0002s12410.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-70myb domain protein r1